Lineage for d1p0yc1 (1p0y C:311-487)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650549Fold a.166: RuBisCo LSMT C-terminal, substrate-binding domain [81821] (1 superfamily)
    multihelical; irregular array of long and short helices
  4. 650550Superfamily a.166.1: RuBisCo LSMT C-terminal, substrate-binding domain [81822] (1 family) (S)
  5. 650551Family a.166.1.1: RuBisCo LSMT C-terminal, substrate-binding domain [81823] (1 protein)
  6. 650552Protein RuBisCo LSMT C-terminal, substrate-binding domain [81824] (1 species)
  7. 650553Species Garden pea (Pisum sativum) [TaxId:3888] [81825] (7 PDB entries)
  8. 650556Domain d1p0yc1: 1p0y C:311-487 [87658]
    Other proteins in same PDB: d1p0ya2, d1p0yb2, d1p0yc2
    complexed with mlz, sah

Details for d1p0yc1

PDB Entry: 1p0y (more details), 2.55 Å

PDB Description: crystal structure of the set domain of lsmt bound to melysine and adohcy
PDB Compounds: (C:) Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplast

SCOP Domain Sequences for d1p0yc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p0yc1 a.166.1.1 (C:311-487) RuBisCo LSMT C-terminal, substrate-binding domain {Garden pea (Pisum sativum) [TaxId: 3888]}
aytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlvalggtdaf
lleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelkegnldsrl
aiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdilenlyf

SCOP Domain Coordinates for d1p0yc1:

Click to download the PDB-style file with coordinates for d1p0yc1.
(The format of our PDB-style files is described here.)

Timeline for d1p0yc1: