Lineage for d1p0yb2 (1p0y B:48-310)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427940Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 2427995Family b.85.7.3: RuBisCo LSMT catalytic domain [82210] (1 protein)
  6. 2427996Protein RuBisCo LSMT catalytic domain [82211] (1 species)
  7. 2427997Species Pea (Pisum sativum) [TaxId:3888] [82212] (7 PDB entries)
  8. 2427999Domain d1p0yb2: 1p0y B:48-310 [87657]
    Other proteins in same PDB: d1p0ya1, d1p0ya3, d1p0yb1, d1p0yb3, d1p0yc1, d1p0yc3
    complexed with mlz, sah

Details for d1p0yb2

PDB Entry: 1p0y (more details), 2.55 Å

PDB Description: crystal structure of the set domain of lsmt bound to melysine and adohcy
PDB Compounds: (B:) Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplast

SCOPe Domain Sequences for d1p0yb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p0yb2 b.85.7.3 (B:48-310) RuBisCo LSMT catalytic domain {Pea (Pisum sativum) [TaxId: 3888]}
pslspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinp
davaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqe
lqgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrl
rnenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqy
dlnksnaelaldygfiepnenrh

SCOPe Domain Coordinates for d1p0yb2:

Click to download the PDB-style file with coordinates for d1p0yb2.
(The format of our PDB-style files is described here.)

Timeline for d1p0yb2: