![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.7: SET domain [82199] (3 families) ![]() duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII also contains a substrate-binding alpha+beta subdomain inserted in the core |
![]() | Family b.85.7.3: RuBisCo LSMT catalytic domain [82210] (1 protein) |
![]() | Protein RuBisCo LSMT catalytic domain [82211] (1 species) |
![]() | Species Garden pea (Pisum sativum) [TaxId:3888] [82212] (3 PDB entries) |
![]() | Domain d1p0yb2: 1p0y B:48-310 [87657] Other proteins in same PDB: d1p0ya1, d1p0yb1, d1p0yc1 |
PDB Entry: 1p0y (more details), 2.55 Å
SCOP Domain Sequences for d1p0yb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p0yb2 b.85.7.3 (B:48-310) RuBisCo LSMT catalytic domain {Garden pea (Pisum sativum)} pslspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinp davaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqe lqgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrl rnenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqy dlnksnaelaldygfiepnenrh
Timeline for d1p0yb2:
![]() Domains from other chains: (mouse over for more information) d1p0ya1, d1p0ya2, d1p0yc1, d1p0yc2 |