SCOP 1.65: Domain d1p0yb2: 1p0y B:48-310

Lineage for d1p0yb2 (1p0y B:48-310)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (3 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core

5. Family b.85.7.3: RuBisCo LSMT catalytic domain [82210] (1 protein)

6. Protein RuBisCo LSMT catalytic domain [82211] (1 species)

7. Species Garden pea (Pisum sativum) [TaxId:3888] [82212] (3 PDB entries)

8. Domain d1p0yb2: 1p0y B:48-310 [87657]
   Other proteins in same PDB: d1p0ya1, d1p0yb1, d1p0yc1

Details for d1p0yb2

PDB Entry: 1p0y, 2.55 Å

PDB Description: crystal structure of the set domain of lsmt bound to melysine and adohcy

SCOP Domain Sequences for d1p0yb2:

Sequence; same for both SEQRES and ATOM records:

>d1p0yb2 b.85.7.3 (B:48-310) RuBisCo LSMT catalytic domain {Garden pea (Pisum sativum)}
pslspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinp
davaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqe
lqgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrl
rnenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqy
dlnksnaelaldygfiepnenrh

Timeline for d1p0yb2:

• d1p0yb2 is new in SCOP 1.65
  
• d1p0yb2 appears in SCOP 1.67
  
• d1p0yb2 appears in the current release, SCOPe 2.08