Lineage for d1p0na_ (1p0n A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080270Protein Isopentenyl-diphosphate delta-isomerase [89454] (3 species)
  7. 2080271Species Bacillus subtilis [TaxId:1423] [89455] (2 PDB entries)
  8. 2080274Domain d1p0na_: 1p0n A: [87651]
    complexed with fmn

Details for d1p0na_

PDB Entry: 1p0n (more details), 2.8 Å

PDB Description: IPP:DMAPP isomerase type II, FMN complex
PDB Compounds: (A:) Isopentenyl-diphosphate delta-isomerase

SCOPe Domain Sequences for d1p0na_:

Sequence, based on SEQRES records: (download)

>d1p0na_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]}
etgldditfvhvslpdlaleqvdistkigelsssspifinamtggggkltyeinkslara
asqagiplavgsqmsalkdpserlsyeivrkenpnglifanlgseataaqakeavemiga
nalqihlnviqeivmpegdrsfsgalkrieqicsrvsvpvivkevgfgmskasagklyea
gaaavdiggyggtnfskienlrrqrqisffnswgistaaslaeirsefpastmiasgglq
daldvakaialgasctgmaghflkaltdsgeeglleeiqlileelklimtvlgartiadl
qkaplvikgethhwltergvntssysvr

Sequence, based on observed residues (ATOM records): (download)

>d1p0na_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]}
etgldditfvhvslpdlaleqvdistkigelsssspifinamtggggkltyeinkslara
asqagiplavgsqmsalkdpserlsyeivrkenpnglifanlgseataaqakeavemiga
nalqihlnviqeifsgalkrieqicsrvsvpvivkevgfgmskasagklyeagaaavdig
grqisffnswgistaaslaeirsefpastmiasgglqdaldvakaialgasctgmaghfl
kaltdsgeeglleeiqlileelklimtvlgartiadlqkaplvikgethhwltergvnts
sysvr

SCOPe Domain Coordinates for d1p0na_:

Click to download the PDB-style file with coordinates for d1p0na_.
(The format of our PDB-style files is described here.)

Timeline for d1p0na_: