SCOPe 2.05: Domain d1p0cb2: 1p0c B:2164-2337

Lineage for d1p0cb2 (1p0c B:2164-2337)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
   N-terminal all-beta domain defines family

6. Protein Alcohol dehydrogenase [51737] (9 species)

7. Species Frog (Rana perezi) [TaxId:8403] [89511] (2 PDB entries)

8. Domain d1p0cb2: 1p0c B:2164-2337 [87641]
   Other proteins in same PDB: d1p0ca1, d1p0cb1
   complexed with gol, po4, zn

Details for d1p0cb2

PDB Entry: 1p0c, 2.2 Å

PDB Description: Crystal Structure of the NADP(H)-Dependent Vertebrate Alcohol Dehydrogenase (ADH8)

PDB Compounds: (B:) NADP-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d1p0cb2:

Sequence; same for both SEQRES and ATOM records:

>d1p0cb2 c.2.1.1 (B:2164-2337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]}
aplescligcgfatgygaavntakvtpgstcavfglggvgfsaivgckaagasriigvgt
hkdkfpkaielgateclnpkdydkpiyevicektnggvdyavecagrietmmnalqstyc
gsgvtvvlglaspnerlpldplllltgrslkgsvfggfkgeevsrlvddymkkk

Timeline for d1p0cb2:

• d1p0cb2 first appeared in SCOP 1.65
  
• d1p0cb2 appears in SCOPe 2.04
  
• d1p0cb2 appears in SCOPe 2.06
  
• d1p0cb2 appears in the current release, SCOPe 2.08