SCOP 1.71: Domain d1ozvc2: 1ozv C:49-310

Lineage for d1ozvc2 (1ozv C:49-310)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (3 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core

5. Family b.85.7.3: RuBisCo LSMT catalytic domain [82210] (1 protein)

6. Protein RuBisCo LSMT catalytic domain [82211] (1 species)

7. Species Garden pea (Pisum sativum) [TaxId:3888] [82212] (3 PDB entries)

8. Domain d1ozvc2: 1ozv C:49-310 [87637]
   Other proteins in same PDB: d1ozva1, d1ozvb1, d1ozvc1
   complexed with lys, sah

Details for d1ozvc2

PDB Entry: 1ozv, 2.65 Å

PDB Description: crystal structure of the set domain of lsmt bound to lysine and adohcy

SCOP Domain Sequences for d1ozvc2:

Sequence; same for both SEQRES and ATOM records:

>d1ozvc2 b.85.7.3 (C:49-310) RuBisCo LSMT catalytic domain {Garden pea (Pisum sativum)}
slspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpd
avaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqel
qgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlr
nenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqyd
lnksnaelaldygfiepnenrh

Timeline for d1ozvc2:

• d1ozvc2 first appeared in SCOP 1.65
  
• d1ozvc2 appears in SCOP 1.69
  
• d1ozvc2 appears in SCOP 1.73
  
• d1ozvc2 appears in the current release, SCOPe 2.08