Lineage for d1ozvb2 (1ozv B:48-310)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811032Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 811316Superfamily b.85.7: SET domain [82199] (3 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 811350Family b.85.7.3: RuBisCo LSMT catalytic domain [82210] (1 protein)
  6. 811351Protein RuBisCo LSMT catalytic domain [82211] (1 species)
  7. 811352Species Garden pea (Pisum sativum) [TaxId:3888] [82212] (7 PDB entries)
  8. 811360Domain d1ozvb2: 1ozv B:48-310 [87635]
    Other proteins in same PDB: d1ozva1, d1ozvb1, d1ozvc1

Details for d1ozvb2

PDB Entry: 1ozv (more details), 2.65 Å

PDB Description: crystal structure of the set domain of lsmt bound to lysine and adohcy
PDB Compounds: (B:) Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplast

SCOP Domain Sequences for d1ozvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ozvb2 b.85.7.3 (B:48-310) RuBisCo LSMT catalytic domain {Garden pea (Pisum sativum) [TaxId: 3888]}
pslspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinp
davaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqe
lqgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrl
rnenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqy
dlnksnaelaldygfiepnenrh

SCOP Domain Coordinates for d1ozvb2:

Click to download the PDB-style file with coordinates for d1ozvb2.
(The format of our PDB-style files is described here.)

Timeline for d1ozvb2: