Lineage for d1ozvb1 (1ozv B:311-488)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450109Fold a.166: RuBisCo LSMT C-terminal, substrate-binding domain [81821] (1 superfamily)
    multihelical; irregular array of long and short helices
  4. 450110Superfamily a.166.1: RuBisCo LSMT C-terminal, substrate-binding domain [81822] (1 family) (S)
  5. 450111Family a.166.1.1: RuBisCo LSMT C-terminal, substrate-binding domain [81823] (1 protein)
  6. 450112Protein RuBisCo LSMT C-terminal, substrate-binding domain [81824] (1 species)
  7. 450113Species Garden pea (Pisum sativum) [TaxId:3888] [81825] (3 PDB entries)
  8. 450121Domain d1ozvb1: 1ozv B:311-488 [87634]
    Other proteins in same PDB: d1ozva2, d1ozvb2, d1ozvc2

Details for d1ozvb1

PDB Entry: 1ozv (more details), 2.65 Å

PDB Description: crystal structure of the set domain of lsmt bound to lysine and adohcy

SCOP Domain Sequences for d1ozvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ozvb1 a.166.1.1 (B:311-488) RuBisCo LSMT C-terminal, substrate-binding domain {Garden pea (Pisum sativum)}
aytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlvalggtdaf
lleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelkegnldsrl
aiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdilenlyfq

SCOP Domain Coordinates for d1ozvb1:

Click to download the PDB-style file with coordinates for d1ozvb1.
(The format of our PDB-style files is described here.)

Timeline for d1ozvb1: