SCOP 1.75: Domain d1ozva2: 1ozv A:50-310

Lineage for d1ozva2 (1ozv A:50-310)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (3 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core

5. Family b.85.7.3: RuBisCo LSMT catalytic domain [82210] (1 protein)

6. Protein RuBisCo LSMT catalytic domain [82211] (1 species)

7. Species Garden pea (Pisum sativum) [TaxId:3888] [82212] (7 PDB entries)

8. Domain d1ozva2: 1ozv A:50-310 [87633]
   Other proteins in same PDB: d1ozva1, d1ozvb1, d1ozvc1

Details for d1ozva2

PDB Entry: 1ozv, 2.65 Å

PDB Description: crystal structure of the set domain of lsmt bound to lysine and adohcy

PDB Compounds: (A:) Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplast

SCOP Domain Sequences for d1ozva2:

Sequence, based on SEQRES records:

>d1ozva2 b.85.7.3 (A:50-310) RuBisCo LSMT catalytic domain {Garden pea (Pisum sativum) [TaxId: 3888]}
lspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpda
vaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqelq
gsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlrn
enlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqydl
nksnaelaldygfiepnenrh

Sequence, based on observed residues (ATOM records):

>d1ozva2 b.85.7.3 (A:50-310) RuBisCo LSMT catalytic domain {Garden pea (Pisum sativum) [TaxId: 3888]}
lspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpda
vaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqelq
gsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlrn
enlvvvpmadlinhsagvttedhayevkylfslksplsvkageqvyiqydlnksnaelal
dygfiepnenrh

Timeline for d1ozva2:

• d1ozva2 first appeared in SCOP 1.65
  
• d1ozva2 appears in SCOP 1.73
  
• d1ozva2 appears in SCOPe 2.01
  
• d1ozva2 appears in the current release, SCOPe 2.08