Lineage for d1ozva2 (1ozv A:50-310)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818606Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
    Pfam PF00856
  5. 2818661Family b.85.7.3: RuBisCo LSMT catalytic domain [82210] (1 protein)
  6. 2818662Protein RuBisCo LSMT catalytic domain [82211] (1 species)
  7. 2818663Species Pea (Pisum sativum) [TaxId:3888] [82212] (7 PDB entries)
  8. 2818667Domain d1ozva2: 1ozv A:50-310 [87633]
    Other proteins in same PDB: d1ozva1, d1ozva3, d1ozvb1, d1ozvb3, d1ozvc1, d1ozvc3
    complexed with lys, sah

Details for d1ozva2

PDB Entry: 1ozv (more details), 2.65 Å

PDB Description: crystal structure of the set domain of lsmt bound to lysine and adohcy
PDB Compounds: (A:) Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplast

SCOPe Domain Sequences for d1ozva2:

Sequence, based on SEQRES records: (download)

>d1ozva2 b.85.7.3 (A:50-310) RuBisCo LSMT catalytic domain {Pea (Pisum sativum) [TaxId: 3888]}
lspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpda
vaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqelq
gsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlrn
enlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqydl
nksnaelaldygfiepnenrh

Sequence, based on observed residues (ATOM records): (download)

>d1ozva2 b.85.7.3 (A:50-310) RuBisCo LSMT catalytic domain {Pea (Pisum sativum) [TaxId: 3888]}
lspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpda
vaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqelq
gsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlrn
enlvvvpmadlinhsagvttedhayevkylfslksplsvkageqvyiqydlnksnaelal
dygfiepnenrh

SCOPe Domain Coordinates for d1ozva2:

Click to download the PDB-style file with coordinates for d1ozva2.
(The format of our PDB-style files is described here.)

Timeline for d1ozva2: