Class a: All alpha proteins [46456] (284 folds) |
Fold a.166: RuBisCo LSMT C-terminal, substrate-binding domain [81821] (1 superfamily) multihelical; irregular array of long and short helices |
Superfamily a.166.1: RuBisCo LSMT C-terminal, substrate-binding domain [81822] (1 family) |
Family a.166.1.1: RuBisCo LSMT C-terminal, substrate-binding domain [81823] (1 protein) |
Protein RuBisCo LSMT C-terminal, substrate-binding domain [81824] (1 species) |
Species Pea (Pisum sativum) [TaxId:3888] [81825] (7 PDB entries) |
Domain d1ozva1: 1ozv A:311-487 [87632] Other proteins in same PDB: d1ozva2, d1ozvb2, d1ozvc2 complexed with lys, sah |
PDB Entry: 1ozv (more details), 2.65 Å
SCOPe Domain Sequences for d1ozva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ozva1 a.166.1.1 (A:311-487) RuBisCo LSMT C-terminal, substrate-binding domain {Pea (Pisum sativum) [TaxId: 3888]} aytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlvalggtdaf lleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelkegnldsrl aiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdilenlyf
Timeline for d1ozva1:
View in 3D Domains from other chains: (mouse over for more information) d1ozvb1, d1ozvb2, d1ozvc1, d1ozvc2 |