SCOPe 2.07: Domain d1ozth_: 1ozt H:

Lineage for d1ozth_ (1ozt H:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49333] (95 PDB entries)

8. Domain d1ozth_: 1ozt H: [87623]
   mutant

Details for d1ozth_

PDB Entry: 1ozt, 2.5 Å

PDB Description: crystal structure of apo-h46r familial als mutant human cu,zn superoxide dismutase (cuznsod) to 2.5a resolution

PDB Compounds: (H:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d1ozth_:

Sequence, based on SEQRES records:

>d1ozth_ b.1.8.1 (H:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

Sequence, based on observed residues (ATOM records):

>d1ozth_ b.1.8.1 (H:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
gphfnplrhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekaddlgkggn
eagsrlacgvigiaq

Timeline for d1ozth_:

• d1ozth_ first appeared in SCOP 1.65
  
• d1ozth_ appears in SCOPe 2.06
  
• d1ozth_ appears in the current release, SCOPe 2.08