Lineage for d1ozth_ (1ozt H:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 291100Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
    has additional strand at N-terminus
  5. 291101Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 291114Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)
  7. 291179Species Human (Homo sapiens) [TaxId:9606] [49333] (16 PDB entries)
  8. 291223Domain d1ozth_: 1ozt H: [87623]

Details for d1ozth_

PDB Entry: 1ozt (more details), 2.5 Å

PDB Description: crystal structure of apo-h46r familial als mutant human cu,zn superoxide dismutase (cuznsod) to 2.5a resolution

SCOP Domain Sequences for d1ozth_:

Sequence, based on SEQRES records: (download)

>d1ozth_ b.1.8.1 (H:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens)}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

Sequence, based on observed residues (ATOM records): (download)

>d1ozth_ b.1.8.1 (H:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens)}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
gphfnplrhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekaddlgkggn
eagsrlacgvigiaq

SCOP Domain Coordinates for d1ozth_:

Click to download the PDB-style file with coordinates for d1ozth_.
(The format of our PDB-style files is described here.)

Timeline for d1ozth_: