SCOP 1.67: Domain d1oztg_: 1ozt G:

Lineage for d1oztg_ (1ozt G:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49333] (22 PDB entries)

8. Domain d1oztg_: 1ozt G: [87622]

Details for d1oztg_

PDB Entry: 1ozt, 2.5 Å

PDB Description: crystal structure of apo-h46r familial als mutant human cu,zn superoxide dismutase (cuznsod) to 2.5a resolution

SCOP Domain Sequences for d1oztg_:

Sequence, based on SEQRES records:

>d1oztg_ b.1.8.1 (G:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens)}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

Sequence, based on observed residues (ATOM records):

>d1oztg_ b.1.8.1 (G:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens)}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
gphfnplerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekaddlggsr
lacgvigiaq

Timeline for d1oztg_:

• d1oztg_ first appeared in SCOP 1.65
  
• d1oztg_ appears in SCOP 1.69
  
• d1oztg_ appears in the current release, SCOPe 2.08