Class g: Small proteins [56992] (90 folds) |
Fold g.69: Plant proteinase inhibitors [100896] (1 superfamily) disulfide-rich small alpha+beta fold; topological similarity to the Ovomucoid domain III |
Superfamily g.69.1: Plant proteinase inhibitors [100897] (1 family) |
Family g.69.1.1: Plant proteinase inhibitors [57486] (3 proteins) |
Protein Wound-induced proteinase inhibitor-II [90168] (1 species) two-domain inhibitor; consists of one continuous domain of canonical fold and one discontinuous, circularly-permutated domain |
Species Tomato (Lycopersicon esculentum) [TaxId:4081] [90169] (2 PDB entries) |
Domain d1oyvi_: 1oyv I: [87620] Other proteins in same PDB: d1oyva_, d1oyvb_ complexed with ca |
PDB Entry: 1oyv (more details), 2.5 Å
SCOPe Domain Sequences for d1oyvi_:
Sequence, based on SEQRES records: (download)
>d1oyvi_ g.69.1.1 (I:) Wound-induced proteinase inhibitor-II {Tomato (Lycopersicon esculentum) [TaxId: 4081]} kactrecgnlgfgicprsegsplnpicinccsgykgcnyynsfgkficegesdpkrpnac tfncdpniaysrcprsqgksliyptgcttcctgykgcyyfgkdgkfvcegesdepk
>d1oyvi_ g.69.1.1 (I:) Wound-induced proteinase inhibitor-II {Tomato (Lycopersicon esculentum) [TaxId: 4081]} kactrecgnlgfgicprsegsplnpicinccsgykgcnyynsfgkficegesdpkrpnac tfncdpniaysrcgcttcctgykgcyyfgkdgkfvcegesdepk
Timeline for d1oyvi_: