Lineage for d1oyvi_ (1oyv I:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 343161Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily)
    disulphide-rich small alpha+beta fold
  4. 343162Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families) (S)
    two families share the same beta-sheet topology but differ in the active-site loop location
  5. 343242Family g.15.1.2: Plant proteinase inhibitors [57486] (3 proteins)
  6. 343253Protein Wound-induced proteinase inhibitor-II [90168] (1 species)
    two-domain inhibitor; consists of one continuous domain of canonical fold and one discontinuous, circularly-permutated domain
  7. 343254Species Tomato (Lycopersicon esculentum) [TaxId:4081] [90169] (1 PDB entry)
  8. 343255Domain d1oyvi_: 1oyv I: [87620]
    Other proteins in same PDB: d1oyva_, d1oyvb_
    complexed with ca

Details for d1oyvi_

PDB Entry: 1oyv (more details), 2.5 Å

PDB Description: crystal structure of tomato inhibitor-ii in a ternary complex with subtilisin carlsberg

SCOP Domain Sequences for d1oyvi_:

Sequence, based on SEQRES records: (download)

>d1oyvi_ g.15.1.2 (I:) Wound-induced proteinase inhibitor-II {Tomato (Lycopersicon esculentum)}
kactrecgnlgfgicprsegsplnpicinccsgykgcnyynsfgkficegesdpkrpnac
tfncdpniaysrcprsqgksliyptgcttcctgykgcyyfgkdgkfvcegesdepk

Sequence, based on observed residues (ATOM records): (download)

>d1oyvi_ g.15.1.2 (I:) Wound-induced proteinase inhibitor-II {Tomato (Lycopersicon esculentum)}
kactrecgnlgfgicprsegsplnpicinccsgykgcnyynsfgkficegesdpkrpnac
tfncdpniaysrcgcttcctgykgcyyfgkdgkfvcegesdepk

SCOP Domain Coordinates for d1oyvi_:

Click to download the PDB-style file with coordinates for d1oyvi_.
(The format of our PDB-style files is described here.)

Timeline for d1oyvi_: