Class g: Small proteins [56992] (66 folds) |
Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily) disulphide-rich small alpha+beta fold |
Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families) two families share the same beta-sheet topology but differ in the active-site loop location |
Family g.15.1.2: Plant proteinase inhibitors [57486] (3 proteins) |
Protein Wound-induced proteinase inhibitor-II [90168] (1 species) two-domain inhibitor; consists of one continuous domain of canonical fold and one discontinuous, circularly-permutated domain |
Species Tomato (Lycopersicon esculentum) [TaxId:4081] [90169] (1 PDB entry) |
Domain d1oyvi_: 1oyv I: [87620] Other proteins in same PDB: d1oyva_, d1oyvb_ complexed with ca |
PDB Entry: 1oyv (more details), 2.5 Å
SCOP Domain Sequences for d1oyvi_:
Sequence, based on SEQRES records: (download)
>d1oyvi_ g.15.1.2 (I:) Wound-induced proteinase inhibitor-II {Tomato (Lycopersicon esculentum)} kactrecgnlgfgicprsegsplnpicinccsgykgcnyynsfgkficegesdpkrpnac tfncdpniaysrcprsqgksliyptgcttcctgykgcyyfgkdgkfvcegesdepk
>d1oyvi_ g.15.1.2 (I:) Wound-induced proteinase inhibitor-II {Tomato (Lycopersicon esculentum)} kactrecgnlgfgicprsegsplnpicinccsgykgcnyynsfgkficegesdpkrpnac tfncdpniaysrcgcttcctgykgcyyfgkdgkfvcegesdepk
Timeline for d1oyvi_: