Lineage for d1oync_ (1oyn C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018901Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2018902Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2018992Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2019055Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 2019056Species Human (Homo sapiens) [TaxId:9606] [89152] (39 PDB entries)
    Uniprot Q08499 388-713
  8. 2019106Domain d1oync_: 1oyn C: [87611]
    complexed with rol, zn

Details for d1oync_

PDB Entry: 1oyn (more details), 2 Å

PDB Description: Crystal structure of PDE4D2 in complex with (R,S)-rolipram
PDB Compounds: (C:) cAMP-specific phosphodiesterase PDE4D2

SCOPe Domain Sequences for d1oync_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oync_ a.211.1.2 (C:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstipq

SCOPe Domain Coordinates for d1oync_:

Click to download the PDB-style file with coordinates for d1oync_.
(The format of our PDB-style files is described here.)

Timeline for d1oync_: