![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.125: PDEase [48546] (1 superfamily) multihelical; can be divided into three subdomains |
![]() | Superfamily a.125.1: PDEase [48547] (1 family) ![]() |
![]() | Family a.125.1.1: PDEase [48548] (4 proteins) 3',5'-cyclic-nucleotide phosphodiesterase, Pfam 00233 |
![]() | Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89152] (5 PDB entries) |
![]() | Domain d1oync_: 1oyn C: [87611] |
PDB Entry: 1oyn (more details), 2 Å
SCOP Domain Sequences for d1oync_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oync_ a.125.1.1 (C:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens)} teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa dlvhpdaqdildtlednrewyqstipq
Timeline for d1oync_: