SCOPe 2.08: Domain d1oyjb1: 1oyj B:86-227

Lineage for d1oyjb1 (1oyj B:86-227)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class tau GST [81354] (2 species)

7. Species Rice (Oryza sativa) [TaxId:4530] [89062] (1 PDB entry)

8. Domain d1oyjb1: 1oyj B:86-227 [87599]
   Other proteins in same PDB: d1oyja2, d1oyjb2, d1oyjc2, d1oyjd2
   complexed with cl, gol, gsh, mg

Details for d1oyjb1

PDB Entry: 1oyj, 1.95 Å

PDB Description: Crystal structure solution of Rice GST1 (OsGSTU1) in complex with glutathione.

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d1oyjb1:

Sequence, based on SEQRES records:

>d1oyjb1 a.45.1.1 (B:86-227) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]}
llppansgdadaayaratarfwadyvdrklydcgsrlwrlkgepqaaagremaeilrtle
aelgdreffggggggrlgfvdvalvpftawfysyercggfsveevaprlaawarrcgrid
svvkhlpspekvydfvgvlkkk

Sequence, based on observed residues (ATOM records):

>d1oyjb1 a.45.1.1 (B:86-227) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]}
llppansdadaayaratarfwadyvdrklydcgsrlwrlkgepqaaagremaeilrtlea
elgdreffggggggrlgfvdvalvpftawfysyercggfsveevaprlaawarrcgrids
vvkhlpspekvydfvgvlkkk

Timeline for d1oyjb1:

• d1oyjb1 first appeared in SCOP 1.65
  
• d1oyjb1 appears in SCOPe 2.07