SCOPe 2.05: Domain d1oyfb_: 1oyf B:

Lineage for d1oyfb_ (1oyf B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (36 species)

7. Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (35 PDB entries)
   Uniprot P59071

8. Domain d1oyfb_: 1oyf B: [87596]
   complexed with acy, mhn, so4

Details for d1oyfb_

PDB Entry: 1oyf, 2.45 Å

PDB Description: Crystal Structure of Russelles viper (Daboia russellii pulchella) phospholipase A2 in a complex with venom 6-methyl heptanol

PDB Compounds: (B:) phospholipase a2

SCOPe Domain Sequences for d1oyfb_:

Sequence; same for both SEQRES and ATOM records:

>d1oyfb_ a.133.1.2 (B:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgrlaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

Timeline for d1oyfb_:

• d1oyfb_ first appeared in SCOP 1.65
  
• d1oyfb_ appears in SCOPe 2.04
  
• d1oyfb_ appears in SCOPe 2.06
  
• d1oyfb_ appears in the current release, SCOPe 2.08