SCOPe 2.08: Domain d1oyda2: 1oyd A:135-181,A:274-330

Lineage for d1oyda2 (1oyd A:135-181,A:274-330)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.44: Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82693] (1 family)
   duplication: the N- and C-terminal halves of the whole proteins are structurally similar; each half contains two domains of this fold

5. Family d.58.44.1: Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82694] (1 protein)

6. Protein Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82695] (1 species)
   PN2 and PC2 subdomains are interrupted by the inserted subdomains DN and DC, respectively

7. Species Escherichia coli [TaxId:562] [82696] (7 PDB entries)

8. Domain d1oyda2: 1oyd A:135-181,A:274-330 [87580]
   Other proteins in same PDB: d1oyda5, d1oyda6, d1oyda7, d1oyda8
   complexed with deq

Details for d1oyda2

PDB Entry: 1oyd, 3.8 Å

PDB Description: Structural Basis of Multiple Binding Capacity of the AcrB multidrug Efflux Pump

PDB Compounds: (A:) Acriflavine resistance protein B

SCOPe Domain Sequences for d1oyda2:

Sequence; same for both SEQRES and ATOM records:

>d1oyda2 d.58.44.1 (A:135-181,A:274-330) Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains {Escherichia coli [TaxId: 562]}
sflmvvgvintdgtmtqedisdyvaanmkdaisrtsgvgdvqlfgsqXnydiiaefngqp
asglgiklatganaldtaaairaelakmepffpsglkivypydtt

Timeline for d1oyda2:

• d1oyda2 first appeared in SCOP 1.65
  
• d1oyda2 appears in SCOPe 2.07