Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.44: Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82693] (1 family) duplication: the N- and C-terminal halves of the whole proteins are structurally similar; each half contains two domains of this fold |
Family d.58.44.1: Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82694] (1 protein) |
Protein Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82695] (1 species) PN2 and PC2 subdomains are interrupted by the inserted subdomains DN and DC, respectively |
Species Escherichia coli [TaxId:562] [82696] (7 PDB entries) |
Domain d1oyda1: 1oyd A:38-134 [87579] Other proteins in same PDB: d1oyda5, d1oyda6, d1oyda7, d1oyda8 complexed with deq |
PDB Entry: 1oyd (more details), 3.8 Å
SCOPe Domain Sequences for d1oyda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oyda1 d.58.44.1 (A:38-134) Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains {Escherichia coli [TaxId: 562]} iappavtisasypgadaktvqdtvtqvieqnmngidnlmymssnsdstgtvqitltfesg tdadiaqvqvqnklqlampllpqevqqqgvsveksss
Timeline for d1oyda1: