SCOPe 2.05: Domain d1oy1c_: 1oy1 C:

Lineage for d1oy1c_ (1oy1 C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) [89606] (1 species)
   involved in an early stage of isoprenoid biosynthesis; contains a Cys-Glu putative catalytic dyad

7. Species Escherichia coli [TaxId:562] [89607] (2 PDB entries)

8. Domain d1oy1c_: 1oy1 C: [87550]
   structural genomics; NESG target ER105

Details for d1oy1c_

PDB Entry: 1oy1, 2.95 Å

PDB Description: X-Ray Structure Of ElbB From E. Coli. Northeast Structural Genomics Research Consortium (Nesg) Target Er105

PDB Compounds: (C:) PUTATIVE sigma cross-reacting protein 27A

SCOPe Domain Sequences for d1oy1c_:

Sequence; same for both SEQRES and ATOM records:

>d1oy1c_ c.23.16.2 (C:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]}
mkkigvilsgcgvydgseiheavltllaisrsgaqavcfapdkqqvdvinhltgeamtet
rnvlieaaritrgeirplaqadaaeldalivpggfgaaknlsnfaslgsectvdrelkal
aqamhqagkplgfmciapamlpkifdfplrltigtdidtaevleemgaehvpcpvddivv
dednkivttpaymlaqniaeaasgidklvsrvlvlae

Timeline for d1oy1c_:

• d1oy1c_ first appeared in SCOP 1.65
  
• d1oy1c_ appears in SCOPe 2.04
  
• d1oy1c_ appears in SCOPe 2.06
  
• d1oy1c_ appears in the current release, SCOPe 2.08