Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins) contains a catalytic triad or dyad different from the class I GAT triad |
Protein Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) [89606] (1 species) involved in an early stage of isoprenoid biosynthesis; contains a Cys-Glu putative catalytic dyad |
Species Escherichia coli [TaxId:562] [89607] (2 PDB entries) |
Domain d1oy1a1: 1oy1 A:4-220 [87548] Other proteins in same PDB: d1oy1a2, d1oy1b2 structural genomics; NESG target ER105 |
PDB Entry: 1oy1 (more details), 2.95 Å
SCOPe Domain Sequences for d1oy1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oy1a1 c.23.16.2 (A:4-220) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]} mkkigvilsgcgvydgseiheavltllaisrsgaqavcfapdkqqvdvinhltgeamtet rnvlieaaritrgeirplaqadaaeldalivpggfgaaknlsnfaslgsectvdrelkal aqamhqagkplgfmciapamlpkifdfplrltigtdidtaevleemgaehvpcpvddivv dednkivttpaymlaqniaeaasgidklvsrvlvlae
Timeline for d1oy1a1:
View in 3D Domains from other chains: (mouse over for more information) d1oy1b1, d1oy1b2, d1oy1c_, d1oy1d_ |