Lineage for d1oy0c_ (1oy0 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2837913Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2838267Family c.1.12.8: Ketopantoate hydroxymethyltransferase PanB [89503] (2 proteins)
    automatically mapped to Pfam PF02548
  6. 2838268Protein Ketopantoate hydroxymethyltransferase PanB [89504] (3 species)
    dodecameric enzyme; a C-terminal helix exchange is observed in the M. tuberculosis enzyme but not in the E. coli enzyme
  7. 2838280Species Mycobacterium tuberculosis [TaxId:1773] [89505] (1 PDB entry)
  8. 2838283Domain d1oy0c_: 1oy0 C: [87545]
    complexed with mg

Details for d1oy0c_

PDB Entry: 1oy0 (more details), 2.8 Å

PDB Description: The crystal Structure of the First Enzyme of Pantothenate Biosynthetic Pathway, Ketopantoate Hydroxymethyltransferase from Mycobacterium Tuberculosis Shows a Decameric Assembly and Terminal Helix-Swapping
PDB Compounds: (C:) Ketopantoate hydroxymethyltransferase

SCOPe Domain Sequences for d1oy0c_:

Sequence, based on SEQRES records: (download)

>d1oy0c_ c.1.12.8 (C:) Ketopantoate hydroxymethyltransferase PanB {Mycobacterium tuberculosis [TaxId: 1773]}
rtkirthhlqrwkadghkwamltaydystarifdeagipvllvgdsaanvvygydttvpi
sideliplvrgvvrgaphalvvadlpfgsyeagptaalaaatrflkdggahavklegger
vaeqiacltaagipvmahigftpqsvntlggfrvqgrgdaaeqtiadaiavaeagafavv
memvpaelatqitgkltiptvgigagpncdgqvlvwqdmagfsgaktarfvkryadvgge
lrraamqyaqevaggvfpadeh

Sequence, based on observed residues (ATOM records): (download)

>d1oy0c_ c.1.12.8 (C:) Ketopantoate hydroxymethyltransferase PanB {Mycobacterium tuberculosis [TaxId: 1773]}
rtkirthhlqrwkadghkwamltaydystarifdeagipvllvgdsaanvvygydttvpi
sideliplvrgvvrgaphalvvadlpfgsyeagptaalaaatrflkdggahavklegger
vaeqiacltaagipvmahigftpgdaaeqtiadaiavaeagafavvmemvpaelatqitg
kltiptvgigagpncdgqvlvwqdmagfsgaktarfvkryadvggelrraamqyaqevag
gvfpadeh

SCOPe Domain Coordinates for d1oy0c_:

Click to download the PDB-style file with coordinates for d1oy0c_.
(The format of our PDB-style files is described here.)

Timeline for d1oy0c_: