Lineage for d1oxvd1 (1oxv D:243-353)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 375107Superfamily b.40.6: MOP-like [50331] (3 families) (S)
  5. 375191Family b.40.6.3: ABC-transporter additional domain [50338] (2 proteins)
    probably stems out from the biMOP domain
  6. 375192Protein Glucose transport protein GlcV, N-terminal domain [89335] (1 species)
  7. 375193Species Archaeon Sulfolobus solfataricus [TaxId:2287] [89336] (5 PDB entries)
  8. 375198Domain d1oxvd1: 1oxv D:243-353 [87537]
    Other proteins in same PDB: d1oxva2, d1oxvb2, d1oxvd2
    complexed with anp, iod, mg

Details for d1oxvd1

PDB Entry: 1oxv (more details), 1.95 Å

PDB Description: Crystal structure of GlcV, the ABC-ATPase of the glucose ABC transporter from Sulfolobus solfataricus

SCOP Domain Sequences for d1oxvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oxvd1 b.40.6.3 (D:243-353) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus}
einelegkvtnegvvigslrfpvsvssdraiigirpedvklskdvikddswilvgkgkvk
vigyqgglfrititpldseeeiftysdhpihsgeevlvyvrkdkikvfekn

SCOP Domain Coordinates for d1oxvd1:

Click to download the PDB-style file with coordinates for d1oxvd1.
(The format of our PDB-style files is described here.)

Timeline for d1oxvd1: