SCOPe 2.05: Domain d1oxvb1: 1oxv B:243-353

Lineage for d1oxvb1 (1oxv B:243-353)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.6: MOP-like [50331] (4 families)

5. Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
   probably stems out from the biMOP domain

6. Protein Glucose transport protein GlcV, N-terminal domain [89335] (1 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [89336] (5 PDB entries)

8. Domain d1oxvb1: 1oxv B:243-353 [87535]
   Other proteins in same PDB: d1oxva2, d1oxvb2, d1oxvd2
   complexed with anp, iod, mg

Details for d1oxvb1

PDB Entry: 1oxv, 1.95 Å

PDB Description: Crystal structure of GlcV, the ABC-ATPase of the glucose ABC transporter from Sulfolobus solfataricus

PDB Compounds: (B:) ABC transporter, ATP binding protein

SCOPe Domain Sequences for d1oxvb1:

Sequence; same for both SEQRES and ATOM records:

>d1oxvb1 b.40.6.3 (B:243-353) Glucose transport protein GlcV, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
einelegkvtnegvvigslrfpvsvssdraiigirpedvklskdvikddswilvgkgkvk
vigyqgglfrititpldseeeiftysdhpihsgeevlvyvrkdkikvfekn

Timeline for d1oxvb1:

• d1oxvb1 first appeared in SCOP 1.65
  
• d1oxvb1 appears in SCOPe 2.04
  
• d1oxvb1 appears in SCOPe 2.06
  
• d1oxvb1 appears in the current release, SCOPe 2.08