| Class b: All beta proteins [48724] (126 folds) |
| Fold b.40: OB-fold [50198] (9 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.6: MOP-like [50331] (3 families) ![]() |
| Family b.40.6.3: ABC-transporter additional domain [50338] (2 proteins) probably stems out from the biMOP domain |
| Protein Glucose transport protein GlcV, N-terminal domain [89335] (1 species) |
| Species Archaeon Sulfolobus solfataricus [TaxId:2287] [89336] (4 PDB entries) |
| Domain d1oxvb1: 1oxv B:243-353 [87535] Other proteins in same PDB: d1oxva2, d1oxvb2, d1oxvd2 |
PDB Entry: 1oxv (more details), 1.95 Å
SCOP Domain Sequences for d1oxvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oxvb1 b.40.6.3 (B:243-353) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus}
einelegkvtnegvvigslrfpvsvssdraiigirpedvklskdvikddswilvgkgkvk
vigyqgglfrititpldseeeiftysdhpihsgeevlvyvrkdkikvfekn
Timeline for d1oxvb1:
View in 3DDomains from other chains: (mouse over for more information) d1oxva1, d1oxva2, d1oxvd1, d1oxvd2 |