| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology missing some secondary structures that made up less than one-third of the common domain |
| Protein Glucose transport protein GlcV, N-terminal domain [89681] (1 species) |
| Species Sulfolobus solfataricus [TaxId:2287] [89682] (5 PDB entries) |
| Domain d1oxub2: 1oxu B:1-242 [87530] Other proteins in same PDB: d1oxua1, d1oxub1, d1oxuc1 complexed with adp, iod, mg |
PDB Entry: 1oxu (more details), 2.1 Å
SCOPe Domain Sequences for d1oxub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oxub2 c.37.1.12 (B:1-242) Glucose transport protein GlcV, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
mvriivknvskvfkkgkvvaldnvniniengerfgilgpsgagkttfmriiagldvpstg
elyfddrlvasngklivppedrkigmvfqtwalypnltafeniafpltnmkmskeeirkr
veevakildihhvlnhfprelsggqqqrvalaralvkdpslllldepfsnldarmrdsar
alvkevqsrlgvtllvvshdpadifaiadrvgvlvkgklvqvgkpedlydnpvsiqvasl
ig
Timeline for d1oxub2:
View in 3DDomains from other chains: (mouse over for more information) d1oxua1, d1oxua2, d1oxuc1, d1oxuc2 |