SCOPe 2.06: Domain d1oxua2: 1oxu A:1-242

Lineage for d1oxua2 (1oxu A:1-242)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein Glucose transport protein GlcV, N-terminal domain [89681] (1 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [89682] (5 PDB entries)

8. Domain d1oxua2: 1oxu A:1-242 [87528]
   Other proteins in same PDB: d1oxua1, d1oxub1, d1oxuc1
   complexed with adp, iod, mg

Details for d1oxua2

PDB Entry: 1oxu, 2.1 Å

PDB Description: Crystal structure of GlcV, the ABC-ATPase of the glucose ABC transporter from Sulfolobus solfataricus

PDB Compounds: (A:) ABC transporter, ATP binding protein

SCOPe Domain Sequences for d1oxua2:

Sequence; same for both SEQRES and ATOM records:

>d1oxua2 c.37.1.12 (A:1-242) Glucose transport protein GlcV, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
mvriivknvskvfkkgkvvaldnvniniengerfgilgpsgagkttfmriiagldvpstg
elyfddrlvasngklivppedrkigmvfqtwalypnltafeniafpltnmkmskeeirkr
veevakildihhvlnhfprelsggqqqrvalaralvkdpslllldepfsnldarmrdsar
alvkevqsrlgvtllvvshdpadifaiadrvgvlvkgklvqvgkpedlydnpvsiqvasl
ig

Timeline for d1oxua2:

• d1oxua2 first appeared in SCOP 1.65
  
• d1oxua2 appears in SCOPe 2.05
  
• d1oxua2 appears in SCOPe 2.07
  
• d1oxua2 appears in the current release, SCOPe 2.08