| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.12: ABC transporter ATPase domain-like [52686] (14 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
| Protein Glucose transport protein GlcV, N-terminal domain [89681] (1 species) |
| Species Archaeon Sulfolobus solfataricus [TaxId:2287] [89682] (4 PDB entries) |
| Domain d1oxua2: 1oxu A:1-242 [87528] Other proteins in same PDB: d1oxua1, d1oxub1, d1oxuc1 |
PDB Entry: 1oxu (more details), 2.1 Å
SCOP Domain Sequences for d1oxua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oxua2 c.37.1.12 (A:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus}
mvriivknvskvfkkgkvvaldnvniniengerfgilgpsgagkttfmriiagldvpstg
elyfddrlvasngklivppedrkigmvfqtwalypnltafeniafpltnmkmskeeirkr
veevakildihhvlnhfprelsggqqqrvalaralvkdpslllldepfsnldarmrdsar
alvkevqsrlgvtllvvshdpadifaiadrvgvlvkgklvqvgkpedlydnpvsiqvasl
ig
Timeline for d1oxua2:
View in 3DDomains from other chains: (mouse over for more information) d1oxub1, d1oxub2, d1oxuc1, d1oxuc2 |