Lineage for d1oxua2 (1oxu A:1-242)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 314354Family c.37.1.12: ABC transporter ATPase domain-like [52686] (14 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 314383Protein Glucose transport protein GlcV, N-terminal domain [89681] (1 species)
  7. 314384Species Archaeon Sulfolobus solfataricus [TaxId:2287] [89682] (4 PDB entries)
  8. 314389Domain d1oxua2: 1oxu A:1-242 [87528]
    Other proteins in same PDB: d1oxua1, d1oxub1, d1oxuc1

Details for d1oxua2

PDB Entry: 1oxu (more details), 2.1 Å

PDB Description: Crystal structure of GlcV, the ABC-ATPase of the glucose ABC transporter from Sulfolobus solfataricus

SCOP Domain Sequences for d1oxua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oxua2 c.37.1.12 (A:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus}
mvriivknvskvfkkgkvvaldnvniniengerfgilgpsgagkttfmriiagldvpstg
elyfddrlvasngklivppedrkigmvfqtwalypnltafeniafpltnmkmskeeirkr
veevakildihhvlnhfprelsggqqqrvalaralvkdpslllldepfsnldarmrdsar
alvkevqsrlgvtllvvshdpadifaiadrvgvlvkgklvqvgkpedlydnpvsiqvasl
ig

SCOP Domain Coordinates for d1oxua2:

Click to download the PDB-style file with coordinates for d1oxua2.
(The format of our PDB-style files is described here.)

Timeline for d1oxua2: