Lineage for d1oxtd1 (1oxt D:243-352)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 297887Superfamily b.40.6: MOP-like [50331] (3 families) (S)
  5. 297971Family b.40.6.3: ABC-transporter additional domain [50338] (2 proteins)
    probably stems out from the biMOP domain
  6. 297972Protein Glucose transport protein GlcV, N-terminal domain [89335] (1 species)
  7. 297973Species Archaeon Sulfolobus solfataricus [TaxId:2287] [89336] (4 PDB entries)
  8. 297983Domain d1oxtd1: 1oxt D:243-352 [87525]
    Other proteins in same PDB: d1oxta2, d1oxtb2, d1oxtd2

Details for d1oxtd1

PDB Entry: 1oxt (more details), 2.1 Å

PDB Description: Crystal structure of GlcV, the ABC-ATPase of the glucose ABC transporter from Sulfolobus solfataricus

SCOP Domain Sequences for d1oxtd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oxtd1 b.40.6.3 (D:243-352) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus}
einelegkvtnegvvigslrfpvsvssdraiigirpedvklskdvikddswilvgkgkvk
vigyqgglfrititpldseeeiftysdhpihsgeevlvyvrkdkikvfek

SCOP Domain Coordinates for d1oxtd1:

Click to download the PDB-style file with coordinates for d1oxtd1.
(The format of our PDB-style files is described here.)

Timeline for d1oxtd1: