SCOP 1.65: Domain d1oxta2: 1oxt A:1-242

Lineage for d1oxta2 (1oxt A:1-242)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (14 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein Glucose transport protein GlcV, N-terminal domain [89681] (1 species)

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [89682] (4 PDB entries)

8. Domain d1oxta2: 1oxt A:1-242 [87522]
   Other proteins in same PDB: d1oxta1, d1oxtb1, d1oxtd1

Details for d1oxta2

PDB Entry: 1oxt, 2.1 Å

PDB Description: Crystal structure of GlcV, the ABC-ATPase of the glucose ABC transporter from Sulfolobus solfataricus

SCOP Domain Sequences for d1oxta2:

Sequence; same for both SEQRES and ATOM records:

>d1oxta2 c.37.1.12 (A:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus}
mvriivknvskvfkkgkvvaldnvniniengerfgilgpsgagkttfmriiagldvpstg
elyfddrlvasngklivppedrkigmvfqtwalypnltafeniafpltnmkmskeeirkr
veevakildihhvlnhfprelsggqqqrvalaralvkdpslllldepfsnldarmrdsar
alvkevqsrlgvtllvvshdpadifaiadrvgvlvkgklvqvgkpedlydnpvsiqvasl
ig

Timeline for d1oxta2:

• d1oxta2 is new in SCOP 1.65
  
• d1oxta2 appears in SCOP 1.67
  
• d1oxta2 appears in the current release, SCOPe 2.08