Class b: All beta proteins [48724] (126 folds) |
Fold b.40: OB-fold [50198] (9 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.6: MOP-like [50331] (3 families) |
Family b.40.6.3: ABC-transporter additional domain [50338] (2 proteins) probably stems out from the biMOP domain |
Protein Glucose transport protein GlcV, N-terminal domain [89335] (1 species) |
Species Archaeon Sulfolobus solfataricus [TaxId:2287] [89336] (4 PDB entries) |
Domain d1oxsc1: 1oxs C:243-352 [87519] Other proteins in same PDB: d1oxsc2 complexed with iod |
PDB Entry: 1oxs (more details), 1.65 Å
SCOP Domain Sequences for d1oxsc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oxsc1 b.40.6.3 (C:243-352) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus} einelegkvtnegvvigslrfpvsvssdraiigirpedvklskdvikddswilvgkgkvk vigyqgglfrititpldseeeiftysdhpihsgeevlvyvrkdkikvfek
Timeline for d1oxsc1: