Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.1: Thiolase-related [53902] (10 proteins) |
Protein Beta-ketoacyl-ACP synthase II [53909] (6 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [89793] (4 PDB entries) |
Domain d1oxhb1: 1oxh B:2-251 [87511] complexed with mg |
PDB Entry: 1oxh (more details), 2.09 Å
SCOPe Domain Sequences for d1oxhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oxhb1 c.95.1.1 (B:2-251) Beta-ketoacyl-ACP synthase II {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} klnrvvvtgygvtspigntpeefwnslatgkigiggitkfdhsdfdvhnaaeiqdfpfdk yfvkkdtnrfdnyslyalyaaqeavnhanldvealnrdrfgvivasgiggikeiedqvlr lhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksintacsssndaigdafrsikfg fqdvmlvggteasitpfaiagfqaltalsttedptrasipfdkdrngfvmgegsgmlvle slehaekrga
Timeline for d1oxhb1: