Lineage for d1oxha2 (1oxh A:252-409)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 322246Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strands 1 & 5 are antiparallel to the rest
  4. 322247Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 322248Family c.95.1.1: Thiolase-related [53902] (6 proteins)
  6. 322299Protein Beta-ketoacyl-ACP synthase II [53909] (4 species)
  7. 322305Species Streptococcus pneumoniae [TaxId:1313] [89793] (2 PDB entries)
  8. 322309Domain d1oxha2: 1oxh A:252-409 [87510]

Details for d1oxha2

PDB Entry: 1oxh (more details), 2.09 Å

PDB Description: the crystal structure of beta-ketoacyl-[acyl carrier protein] synthase ii from streptococcus pneumoniae, triclinic form

SCOP Domain Sequences for d1oxha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oxha2 c.95.1.1 (A:252-409) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae}
tilaevvgygntcdayhmtsphpegqgaikaiklaleeaeispeqvayvnahgtstpane
kgesgaivavlgkevpvsstksftghllgaagaveaivtieamrhnfvpmtagtsevsdy
ieanvvygqglekeipyaisntfgfgghnavlafkrwe

SCOP Domain Coordinates for d1oxha2:

Click to download the PDB-style file with coordinates for d1oxha2.
(The format of our PDB-style files is described here.)

Timeline for d1oxha2: