SCOP 1.65: Domain d1oxha1: 1oxh A:2-251

Lineage for d1oxha1 (1oxh A:2-251)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strands 1 & 5 are antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.1: Thiolase-related [53902] (6 proteins)

6. Protein Beta-ketoacyl-ACP synthase II [53909] (4 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [89793] (2 PDB entries)

8. Domain d1oxha1: 1oxh A:2-251 [87509]

Details for d1oxha1

PDB Entry: 1oxh, 2.09 Å

PDB Description: the crystal structure of beta-ketoacyl-[acyl carrier protein] synthase ii from streptococcus pneumoniae, triclinic form

SCOP Domain Sequences for d1oxha1:

Sequence; same for both SEQRES and ATOM records:

>d1oxha1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae}
klnrvvvtgygvtspigntpeefwnslatgkigiggitkfdhsdfdvhnaaeiqdfpfdk
yfvkkdtnrfdnyslyalyaaqeavnhanldvealnrdrfgvivasgiggikeiedqvlr
lhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksintacsssndaigdafrsikfg
fqdvmlvggteasitpfaiagfqaltalsttedptrasipfdkdrngfvmgegsgmlvle
slehaekrga

Timeline for d1oxha1:

• d1oxha1 is new in SCOP 1.65
  
• d1oxha1 appears in SCOP 1.67
  
• d1oxha1 appears in the current release, SCOPe 2.08