![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
![]() | Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
![]() | Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId:4932] [69449] (4 PDB entries) |
![]() | Domain d1ox6a2: 1ox6 A:-3-229 [87506] Other proteins in same PDB: d1ox6a1, d1ox6b1 complexed with ni, pop, so4 |
PDB Entry: 1ox6 (more details), 2.4 Å
SCOPe Domain Sequences for d1ox6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ox6a2 c.23.16.1 (A:-3-229) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} gshmpvvhvidvesgnlqsltnaiehlgyevqlvkspkdfnisgtsrlilpgvgnyghfv dnlfnrgfekpireyiesgkpimgicvglqalfagsvespkstglnyidfklsrfddsek pvpeigwnscipsenlffgldpykryyfvhsfaailnsekkknlendgwkiakakygsee fiaavnknnifatqfhpeksgkaglnvienflkqqsppipnysaeekellmn
Timeline for d1ox6a2: