Lineage for d1ox5a1 (1ox5 A:230-550)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079054Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 protein domains)
    structural evidence for the gene duplication within the barrel fold
    automatically mapped to Pfam PF00977
  6. 2079055Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species)
  7. 2079056Species Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId:4932] [69379] (4 PDB entries)
  8. 2079061Domain d1ox5a1: 1ox5 A:230-550 [87501]
    Other proteins in same PDB: d1ox5a2, d1ox5a3, d1ox5b2
    complexed with 1pr, ni

Details for d1ox5a1

PDB Entry: 1ox5 (more details), 2.5 Å

PDB Description: towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase
PDB Compounds: (A:) Imidazole glycerol phosphate synthase hisHF

SCOPe Domain Sequences for d1ox5a1:

Sequence, based on SEQRES records: (download)

>d1ox5a1 c.1.2.1 (A:230-550) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]}
dysnygltrriiacldvrtndqgdlvvtkgdqydvreksdgkgvrnlgkpvqlaqkyyqq
gadevtflnitsfrdcplkdtpmlevlkqaaktvfvpltvgggikdivdvdgtkipalev
aslyfrsgadkvsigtdavyaaekyyelgnrgdgtspietiskaygaqavvisvdpkrvy
vnsqadtknkvfeteypgpngekycwyqctikggresrdlgvweltracealgageilln
cidkdgsnsgydleliehvkdavkipviassgagvpehfeeaflktradaclgagmfhrg
eftvndvkeyllehglkvrmd

Sequence, based on observed residues (ATOM records): (download)

>d1ox5a1 c.1.2.1 (A:230-550) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]}
dysnygltrriiacldvrtndqgdlvvtklgkpvqlaqkyyqqgadevtflnitcplkdt
pmlevlkqaaktvfvpltvgggikdivdvdgtkipalevaslyfrsgadkvsigtdavya
aekyyelgnrgdgtspietiskaygaqavvisvdpkrvyvnsqadtknkvfeteypgpng
ekycwyqctikggresrdlgvweltracealgageillncidkdgsnsgydleliehvkd
avkipviassgagvpehfeeaflktradaclgagmfhrgeftvndvkeyllehglkvrmd

SCOPe Domain Coordinates for d1ox5a1:

Click to download the PDB-style file with coordinates for d1ox5a1.
(The format of our PDB-style files is described here.)

Timeline for d1ox5a1: