| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
| Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (4 species) |
| Species Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId:4932] [69449] (4 PDB entries) |
| Domain d1ox4a2: 1ox4 A:1-229 [87498] Other proteins in same PDB: d1ox4a1, d1ox4a3, d1ox4b1, d1ox4b3 complexed with ni, pop, so4 |
PDB Entry: 1ox4 (more details), 2.5 Å
SCOPe Domain Sequences for d1ox4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ox4a2 c.23.16.1 (A:1-229) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]}
mpvvhvidvesgnlqsltnaiehlgyevqlvkspkdfnisgtsrlilpgvgnyghfvdnl
fnrgfekpireyiesgkpimgicvglqalfagsvespkstglnyidfklsrfddsekpvp
eigwnscipsenlffgldpykryyfvhsfaailnsekkknlendgwkiakakygseefia
avnknnifatqfhpeksgkaglnvienflkqqsppipnysaeekellmn
Timeline for d1ox4a2: