Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) |
Family d.58.7.1: Canonical RBD [54929] (20 proteins) |
Protein Lupus LA protein [89940] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89941] (2 PDB entries) |
Domain d1owxa_: 1owx A: [87494] C-terminal RBD |
PDB Entry: 1owx (more details)
SCOP Domain Sequences for d1owxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens)} hhgsleekigcllkfsgdlddqtcredlhilfsnhgeikwidfvrgakegiilfkekake algkakdanngnlqlrnkevtwevlegevekealkkiiedqqeslnkwkskgr
Timeline for d1owxa_: