Lineage for d1owxa_ (1owx A:)
- Root: SCOP 1.67
Class d: Alpha and beta proteins (a+b) [53931] (260 folds) 
Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) 
Family d.58.7.1: Canonical RBD [54929] (20 proteins) 
Protein Lupus LA protein [89940] (1 species) Species Human (Homo sapiens) [TaxId:9606] [89941] (2 PDB entries) 
Domain d1owxa_: 1owx A: [87494]
C-terminal RBD
Details for d1owxa_
PDB Entry: 1owx (more details)
PDB Description: solution structure of the c-terminal rrm of human la (la225-334)
SCOP Domain Sequences for d1owxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens)}
hhgsleekigcllkfsgdlddqtcredlhilfsnhgeikwidfvrgakegiilfkekake
algkakdanngnlqlrnkevtwevlegevekealkkiiedqqeslnkwkskgr
SCOP Domain Coordinates for d1owxa_:
Click to download the PDB-style file with coordinates for d1owxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1owxa_:
- d1owxa_ first appeared in SCOP 1.65
- d1owxa_ appears in SCOP 1.69
- d1owxa_ appears in the current release, SCOPe 2.08, called d1owxa1
View in 3D