Lineage for d1owxa_ (1owx A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 329138Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 329139Family d.58.7.1: Canonical RBD [54929] (16 proteins)
  6. 329172Protein Lupus LA protein [89940] (1 species)
  7. 329173Species Human (Homo sapiens) [TaxId:9606] [89941] (1 PDB entry)
  8. 329174Domain d1owxa_: 1owx A: [87494]
    C-terminal RBD

Details for d1owxa_

PDB Entry: 1owx (more details)

PDB Description: Solution structure of the C-terminal RRM of human La (La225-334)

SCOP Domain Sequences for d1owxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens)}
hhgsleekigcllkfsgdlddqtcredlhilfsnhgeikwidfvrgakegiilfkekake
algkakdanngnlqlrnkevtwevlegevekealkkiiedqqeslnkwkskgr

SCOP Domain Coordinates for d1owxa_:

Click to download the PDB-style file with coordinates for d1owxa_.
(The format of our PDB-style files is described here.)

Timeline for d1owxa_: