Lineage for d1owsa_ (1ows A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 286043Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulphide-linked, and a calcium-binding loop
  4. 286044Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 286049Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 286123Protein Snake phospholipase A2 [48624] (27 species)
  7. 286186Species Indian cobra (Naja naja), a C49 isoform 2 [TaxId:35670] [89166] (1 PDB entry)
  8. 286187Domain d1owsa_: 1ows A: [87491]
    zinc containing heterodimer of two different isoforms
    complexed with nag, zn

Details for d1owsa_

PDB Entry: 1ows (more details), 2.3 Å

PDB Description: crystal structure of a c49 phospholipase a2 from indian cobra reveals carbohydrate binding in the hydrophobic channel

SCOP Domain Sequences for d1owsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owsa_ a.133.1.2 (A:) Snake phospholipase A2 {Indian cobra (Naja naja), a C49 isoform 2}
ntyqfrnmiectvpsrswwdfadygcycgcgsgtptddldrccqvhcncyrqageisgcr
pkfktytyqcsggtltckgnnnacaasscdcdrlaaicfagapyndnnynidlkarcn

SCOP Domain Coordinates for d1owsa_:

Click to download the PDB-style file with coordinates for d1owsa_.
(The format of our PDB-style files is described here.)

Timeline for d1owsa_: