Lineage for d1owga_ (1owg A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715141Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2715142Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2715143Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
    automatically mapped to Pfam PF00216
  6. 2715170Protein Integration host factor alpha subunit (IHFA) [88878] (1 species)
    heterodimer of two related subunits
  7. 2715171Species Escherichia coli [TaxId:562] [88879] (4 PDB entries)
  8. 2715173Domain d1owga_: 1owg A: [87489]
    Other proteins in same PDB: d1owgb_
    protein/DNA complex

Details for d1owga_

PDB Entry: 1owg (more details), 2.1 Å

PDB Description: Crystal structure of WT IHF complexed with an altered H' site (T44A)
PDB Compounds: (A:) Integration host factor alpha-subunit

SCOPe Domain Sequences for d1owga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owga_ a.55.1.1 (A:) Integration host factor alpha subunit (IHFA) {Escherichia coli [TaxId: 562]}
altkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqrp
grnpktgedipitarrvvtfrpgqklksrvenaspk

SCOPe Domain Coordinates for d1owga_:

Click to download the PDB-style file with coordinates for d1owga_.
(The format of our PDB-style files is described here.)

Timeline for d1owga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1owgb_