Lineage for d1owfa_ (1owf A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323932Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2323933Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2323934Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
    automatically mapped to Pfam PF00216
  6. 2323961Protein Integration host factor alpha subunit (IHFA) [88878] (1 species)
    heterodimer of two related subunits
  7. 2323962Species Escherichia coli [TaxId:562] [88879] (4 PDB entries)
  8. 2323963Domain d1owfa_: 1owf A: [87487]
    Other proteins in same PDB: d1owfb_
    protein/DNA complex; mutant

Details for d1owfa_

PDB Entry: 1owf (more details), 1.95 Å

PDB Description: Crystal structure of a mutant IHF (BetaE44A) complexed with the native H' Site
PDB Compounds: (A:) Integration host factor alpha-subunit

SCOPe Domain Sequences for d1owfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owfa_ a.55.1.1 (A:) Integration host factor alpha subunit (IHFA) {Escherichia coli [TaxId: 562]}
altkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqrp
grnpktgedipitarrvvtfrpgqklksrvenaspk

SCOPe Domain Coordinates for d1owfa_:

Click to download the PDB-style file with coordinates for d1owfa_.
(The format of our PDB-style files is described here.)

Timeline for d1owfa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1owfb_