![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily) multihelical |
![]() | Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) ![]() |
![]() | Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (6 proteins) Pfam PF00620 |
![]() | Protein p50 RhoGAP domain [48352] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48353] (4 PDB entries) |
![]() | Domain d1ow3a_: 1ow3 A: [87485] Other proteins in same PDB: d1ow3b_ complexed with gdp, mg, mgf |
PDB Entry: 1ow3 (more details), 1.8 Å
SCOPe Domain Sequences for d1ow3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ow3a_ a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} plpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvrevqq kynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpatlq vlqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlkainp intftkflldhqgelf
Timeline for d1ow3a_: