SCOPe 2.03: Domain d1ow0c1: 1ow0 C:6-100

Lineage for d1ow0c1 (1ow0 C:6-100)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Ig alpha Fc receptor, FCARI (CD89) [89188] (1 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens) [TaxId:9606] [89189] (3 PDB entries)

8. Domain d1ow0c1: 1ow0 C:6-100 [87481]
   Other proteins in same PDB: d1ow0a1, d1ow0a2, d1ow0b1, d1ow0b2
   complexed with IgA1 Fc
   complexed with nag

Details for d1ow0c1

PDB Entry: 1ow0, 3.1 Å

PDB Description: crystal structure of human fcari bound to iga1-fc

PDB Compounds: (C:) Immunoglobulin alpha Fc receptor

SCOPe Domain Sequences for d1ow0c1:

Sequence; same for both SEQRES and ATOM records:

>d1ow0c1 b.1.1.4 (C:6-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]}
pmpfisaksspvipldgsvkiqcqaireayltqlmiiknstyreigrrlkfwnetdpefv
idhmdankagryqcqyrighyrfrysdtlelvvtg

Timeline for d1ow0c1:

• d1ow0c1 first appeared in SCOP 1.65
  
• d1ow0c1 appears in SCOPe 2.02
  
• d1ow0c1 appears in SCOPe 2.04
  
• d1ow0c1 appears in the current release, SCOPe 2.08