SCOPe 2.05: Domain d1ow0a2: 1ow0 A:343-450

Lineage for d1ow0a2 (1ow0 A:343-450)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha [89183] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89184] (2 PDB entries)

8. Domain d1ow0a2: 1ow0 A:343-450 [87478]
   Other proteins in same PDB: d1ow0a1, d1ow0b1, d1ow0c1, d1ow0c2, d1ow0d1, d1ow0d2
   complexed with nag

Details for d1ow0a2

PDB Entry: 1ow0, 3.1 Å

PDB Description: crystal structure of human fcari bound to iga1-fc

PDB Compounds: (A:) Ig alpha-1 chain C region

SCOPe Domain Sequences for d1ow0a2:

Sequence; same for both SEQRES and ATOM records:

>d1ow0a2 b.1.1.2 (A:343-450) Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha {Human (Homo sapiens) [TaxId: 9606]}
ntfrpevhllpppseelalnelvtltclargfspkdvlvrwlqgsqelprekyltwasrq
epsqgtttfavtsilrvaaedwkkgdtfscmvghealplaftqktidr

Timeline for d1ow0a2:

• d1ow0a2 first appeared in SCOP 1.65
  
• d1ow0a2 appears in SCOPe 2.04
  
• d1ow0a2 appears in SCOPe 2.06
  
• d1ow0a2 appears in the current release, SCOPe 2.08