Lineage for d1ovza1 (1ovz A:6-100)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2354769Family b.1.1.4: I set domains [49159] (39 protein domains)
  6. 2354935Protein Ig alpha Fc receptor, FCARI (CD89) [89188] (1 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2354936Species Human (Homo sapiens) [TaxId:9606] [89189] (3 PDB entries)
  8. 2354939Domain d1ovza1: 1ovz A:6-100 [87473]
    Other proteins in same PDB: d1ovza3
    complexed with nag, trs

Details for d1ovza1

PDB Entry: 1ovz (more details), 3 Å

PDB Description: Crystal structure of human FcaRI
PDB Compounds: (A:) Immunoglobulin alpha Fc receptor

SCOPe Domain Sequences for d1ovza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovza1 b.1.1.4 (A:6-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]}
pmpfisaksspvipldgsvkiqcqaireayltqlmiiknstyreigrrlkfwnetdpefv
idhmdankagryqcqyrighyrfrysdtlelvvtg

SCOPe Domain Coordinates for d1ovza1:

Click to download the PDB-style file with coordinates for d1ovza1.
(The format of our PDB-style files is described here.)

Timeline for d1ovza1: